PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn050591
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 184aa    MW: 20356.3 Da    PI: 6.9085
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn050591genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.5e-391776362
      zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                +++lkcprCdstntkfCyynny+lsqPr++Ck+CrryWtkGGalrn+PvGgg+rkn k+s
  Achn050591 17 HEHLKCPRCDSTNTKFCYYNNYNLSQPRHYCKNCRRYWTKGGALRNIPVGGGSRKNTKRS 76
                6789****************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-30675IPR003851Zinc finger, Dof-type
PfamPF027013.8E-331874IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2642074IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102258IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MQDPSTYQQI QPQFPEHEHL KCPRCDSTNT KFCYYNNYNL SQPRHYCKNC RRYWTKGGAL  60
RNIPVGGGSR KNTKRSSNPK RPAPKPDPSD AYGSPSGFDQ DRRILDVGGS FSSLLNGQFG  120
NLLDGLNPIG SADHLGEFVE NPNLNSESNL TRNPEMELQS SENAESFLGV ENGDREPNSS  180
SLG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262218.12e-77PREDICTED: dof zinc finger protein DOF3.1
SwissprotO821553e-42DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLF6HY353e-71F6HY35_VITVI; Putative uncharacterized protein
STRINGVIT_09s0002g02490.t019e-71(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-43DOF zinc finger protein 1